DPCfam | MC186441
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 186 ± 19 aa |
| Residues in low-complexity regions (%) | 14.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 63.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 72.73 |
| Average overlap percent | 7.84 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3NGY6 | 6-165 | 160 | VRYKVVREPGAKIEIEIPPPRPKRKPLHPYPRKRANSCNGANPAAGQPKIAPLSSSSGSDQENGSPVSVLSAMQADAFGSSMSNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PJI0-F1 | 85-281 | 99.00 | 59.66 | View in AlphaFoldDB ↗ |