DPCfam | MC186209
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Residues in low-complexity regions (%) | 8.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.57 |
| Average transmembrane regions | 0.61 |
| Dominant Pfam architecture(s) | PF13367 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0HH81 | 139-196 | 58 | SLAGAWPEETAKALGVVLLMFAGRTWWNRPWHGLVAGVLVGVGFEAFENALYAISLAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FF03-F1 | 123-181 | 95.16 | 96.67 | View in AlphaFoldDB ↗ |