DPCfam | MC186029
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 424 ± 85 aa |
| Residues in low-complexity regions (%) | 2.3 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 17.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03063 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 90.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T4LCN9 | 210-631 | 422 | VRDALTKTMSNITSDPVDLLLTTLRLGIAAGYMGLVATITLQDILLGSPKLVKSAADLGILDPDTVNIVAHGHVPLMATAVIEAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5YHX5-F1 | 28-525 | 100.00 | 97.10 | View in AlphaFoldDB ↗ |