DPCfam | MC18602
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11741 |
| Sequences matching dominant architecture (%) | 94.89 |
| Average overlap percent | 82.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8YV23 | 68-189 | 122 | PGTSAIMLVQTPSGDIVPITGVKANPTEKGVEVILETTLGEKLQITNRSEGNNFIADVPNAQLRLPSGEAFTFRSEKPIAGITEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HUL7-F1 | 27-77 | 43.59 | 94.76 | View in AlphaFoldDB ↗ |