DPCfam | MC185816
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15249 |
| Sequences matching dominant architecture (%) | 94.74 |
| Average overlap percent | 36.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A8SFK1 | 846-904 | 58 | MLDKYRNLLFSESERLGPSAEMVMIDRMFIQEEKVALNQDKILAKERPDEFVASVRML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A240-F1 | 771-822 | 98.11 | 93.65 | View in AlphaFoldDB ↗ |