DPCfam | MC185600
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 861 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 19.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13291 |
| Sequences matching dominant architecture (%) | 90.92 |
| Average overlap percent | 56.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T6A3U7 | 576-712 | 137 | DILLHFAKCCDPLPGDDIIGFITRGRGVTIHTADCPNVLAFGYDSERQIRVHWDERTKVPHQVKIKVTIGEDRPGLLAEISSAIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O54408-F1 | 594-732 | 99.25 | 86.71 | View in AlphaFoldDB ↗ |