DPCfam | MC185566
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 113 ± 24 aa |
| Residues in low-complexity regions (%) | 8.11 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 30.46 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03540 |
| Sequences matching dominant architecture (%) | 92.73 |
| Average overlap percent | 43.84 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2LLW5 | 19-111 | 93 | QQLLIKLEEDLPTIVPEELVMHHFKQAGCNCDDDPQLVKLVAVAGQRFLTAVVNDAVQLAKRKAAAGQGRKAKDLDRRLVLTPDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O04173-F1 | 17-119 | 98.15 | 90.43 | View in AlphaFoldDB ↗ |