DPCfam | MC185286
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Residues in low-complexity regions (%) | 9.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.81 |
| Average transmembrane regions | 3.16 |
| Dominant Pfam architecture(s) | PF03553 |
| Sequences matching dominant architecture (%) | 93.67 |
| Average overlap percent | 42.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A4ZYZ0 | 8-140 | 133 | KPSFLGLIPFFVFIVFYVGTGIILEIQGVEMAFYQMPPLMAMLLAIIVAFILFKDSFIDKLNEFIQGCAQNDIIFISFIFLISGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FVU1-F1 | 1-95 | 71.97 | 92.37 | View in AlphaFoldDB ↗ |