DPCfam | MC18525
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 169 ± 16 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10250 |
| Sequences matching dominant architecture (%) | 84.21 |
| Average overlap percent | 43.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166DDT1 | 282-473 | 192 | GMIWHSVARHMHWAPPLRSLAHEFLSSILGIPYISTDPIPPYIAIHVRRNDFKKICHSVAQEECMAPLSAYAKRVAEVREGLRGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3B1EFP7-F1 | 296-484 | 86.90 | 90.73 | View in AlphaFoldDB ↗ |