DPCfam | MC185214
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 171 ± 19 aa |
| Residues in low-complexity regions (%) | 4.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.48 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D1AYU8 | 9-176 | 167 | LIMMSMITFTRPRYRIDSTLVYGLEFNINNNDQIDNFILLTLGFMPEYRYDYSRKLDFTFGPKISLMGGVAIKNNGAIYYLGRGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CQX4-F1 | 15-103 | 52.57 | 74.67 | View in AlphaFoldDB ↗ |