DPCfam | MC18510
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 400 ± 62 aa |
| Residues in low-complexity regions (%) | 4.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.09 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I9G2R6 | 894-1297 | 404 | NRLQSSTHRAQMRELFIELCLTVPVRLSSLLPYLPLLMDPLVCALNGSSSLIQQGLRTLELCVDNLQPDYLYEHMAPVRAELIRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z435-F1 | 3-279 | 71.53 | 67.52 | View in AlphaFoldDB ↗ |