DPCfam | MC184967
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Residues in low-complexity regions (%) | 2.74 |
| Residues in coiled-coil regions (%) | 12.58 |
| Predicted disordered residues (%) | 5.78 |
| Average transmembrane regions | 0.82 |
| Dominant Pfam architecture(s) | PF08637 |
| Sequences matching dominant architecture (%) | 99.57 |
| Average overlap percent | 28.82 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7QVA0 | 238-321 | 84 | KMAEECSMTAVMNIIMQQARHPIRNSISGSLGQAFILQVQKLKCDVEELMLKSKQMIRAQELNLTLIALVPSLLTAAALTYFIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CRU1-F1 | 450-523 | 98.67 | 88.60 | View in AlphaFoldDB ↗ |