DPCfam | MC184841
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 55.01 |
| Predicted disordered residues (%) | 25.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06511 |
| Sequences matching dominant architecture (%) | 91.94 |
| Average overlap percent | 43.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X6Q768 | 285-355 | 71 | GYNGNGTHELDNAKYQAWQAGFKSQEENLKTTLQTLTQKYSNANSLYDNLVKVLSSTISSCLETAKSFLQG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q56026-F1 | 278-342 | 97.01 | 95.15 | View in AlphaFoldDB ↗ |