DPCfam | MC184820
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 142 ± 31 aa |
| Residues in low-complexity regions (%) | 12.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 60.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15238 |
| Sequences matching dominant architecture (%) | 83.87 |
| Average overlap percent | 66.11 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2NFY0 | 6-213 | 208 | EGGEVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSAADTPAKRPLAAPSAPTVAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6NEQ2-F1 | 61-238 | 99.33 | 62.63 | View in AlphaFoldDB ↗ |