DPCfam | MC184675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1111 |
|---|---|
| Mean domain length (aa) | 256 ± 56 aa |
| Residues in low-complexity regions (%) | 4.47 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 10.72 |
| Average transmembrane regions | 2.78 |
| Dominant Pfam architecture(s) | PF12698 |
| Sequences matching dominant architecture (%) | 87.85 |
| Average overlap percent | 47.27 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8CFT6 | 5-374 | 370 | HLFLLTCRNLVSLARSKYWLIAEFTLPLILVSLQYYTKYSVDLGQQNLTLPKQDTSKIFTPFPIYGNYSDIAVLGSDKILGASHN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8R420-F1 | 19-330 | 97.27 | 82.49 | View in AlphaFoldDB ↗ |