DPCfam | MC18461
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 248 ± 32 aa |
| Residues in low-complexity regions (%) | 7.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.82 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF00041 |
| Sequences matching dominant architecture (%) | 21.82 |
| Average overlap percent | 10.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6LW39 | 262-468 | 207 | NVCVSTSVAGSVAGPCVEYWARQLPPPHQLQVLQETNGSYVLYWRQEQLPANLSAEDYHYVVLVSPGSSLNMSSVKQLKTKSAPY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X1WHE3-F1 | 1959-2213 | 99.60 | 59.24 | View in AlphaFoldDB ↗ |