DPCfam | MC1840
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Residues in low-complexity regions (%) | 3.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03958- PF03958 |
| Sequences matching dominant architecture (%) | 89.83 |
| Average overlap percent | 34.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S2N834 | 253-313 | 61 | LADPRTNSVVIRAPSQARANLAKSLIARLDQESSSKGNIHVVYLKNAEATRVAQTLRAVVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45758-F1 | 231-290 | 93.85 | 86.58 | View in AlphaFoldDB ↗ |