DPCfam | MC183921
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Residues in low-complexity regions (%) | 11.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.07 |
| Average transmembrane regions | 3.14 |
| Dominant Pfam architecture(s) | PF10337 |
| Sequences matching dominant architecture (%) | 98.96 |
| Average overlap percent | 38.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9P347 | 23-178 | 156 | PTKTQTLPSWLNHLNGNDLKTLFRCSVAAWVASLLIYIGPSLHSIGSSTFFAALVLFVTPPAGILLIYLLGSLSLLFGMCLGWAW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2ETV4-F1 | 56-210 | 98.04 | 84.08 | View in AlphaFoldDB ↗ |