DPCfam | MC183773
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 65.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15246 |
| Sequences matching dominant architecture (%) | 96.43 |
| Average overlap percent | 42.11 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5M795 | 1070-1153 | 84 | SAIEQKVMKGIEENMLKLQVQDRGQVVEVKQKTSNGIASWFGLKKSKLPALSRKADVAKLKEDKKEWKLNMPSAGKDPKVATKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O14513-F1 | 1470-1539 | 92.11 | 50.95 | View in AlphaFoldDB ↗ |