DPCfam | MC183672
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Residues in low-complexity regions (%) | 3.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12697 |
| Sequences matching dominant architecture (%) | 55.26 |
| Average overlap percent | 26.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A7991D | 221-313 | 93 | LVEITNGWLDDLPKIAASVEVPLFCALTEFDGLWAVSPERVNGFAGRFSRTLFVEASLWRSAGHNIEHHRLGPAYVRAVLAFADR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ER24-F1 | 199-284 | 96.63 | 96.73 | View in AlphaFoldDB ↗ |