DPCfam | MC183440
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 95 ± 19 aa |
| Residues in low-complexity regions (%) | 5.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00057A86E0 | 8-104 | 97 | TLEQYLNFYEDPWRANLLRAHLDQIIVMHGFIKLHNFPKDLVQRYLGSIELIPPTRSTLDEDISSGALLTVAEVAEDLAALGWHE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MCV4-F1 | 27-123 | 97.00 | 84.84 | View in AlphaFoldDB ↗ |