DPCfam | MC183257
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 1049 ± 98 aa |
| Residues in low-complexity regions (%) | 3.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.74 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03833 |
| Sequences matching dominant architecture (%) | 87.76 |
| Average overlap percent | 84.43 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U3HAN0 | 10-1040 | 1031 | KYFESLQREIDKAYEIAKQARAQGKDPVRDIEVPQATDMAGRVESLVGPKGVAERIRELVEEHGKELAALKVVDEIIEGKFGKFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59024-F1 | 15-1112 | 100.00 | 92.47 | View in AlphaFoldDB ↗ |