DPCfam | MC18251
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 663 ± 48 aa |
| Residues in low-complexity regions (%) | 5.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.84 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13208- PF05099- PF15615 |
| Sequences matching dominant architecture (%) | 85.26 |
| Average overlap percent | 98.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DA61AF | 357-1028 | 672 | WMAPGKSVSVSSVHIAGGLFYLGGFLGKQGRLNENENCLVNPALTVGRGRDTAGISMGYWPSYGGMSPDARRSYLEWLAGTRSNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P9U5-F1 | 60-179 | 17.23 | 92.34 | View in AlphaFoldDB ↗ |