DPCfam | MC182490
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Residues in low-complexity regions (%) | 3.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.74 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF08519 |
| Sequences matching dominant architecture (%) | 97.36 |
| Average overlap percent | 86.05 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I4YEG6 | 498-679 | 182 | ADAISDGDLVDSMIHGSQQQWSLMPIHAIHSTVRPASFMYGGFKSGYGRDTISFPAWLGQYSKTNKYNRALGDIQARMRLKISGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GNU6-F1 | 792-957 | 98.22 | 88.64 | View in AlphaFoldDB ↗ |