DPCfam | MC182214
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 238 ± 34 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.56 |
| Predicted disordered residues (%) | 22.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15082 |
| Sequences matching dominant architecture (%) | 2.7 |
| Average overlap percent | 7.65 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A068X5E6 | 298-499 | 202 | HEKHLYSYDLIKRYLILRKRVESLKPEWGKRRLGLEDFNTSATFKLFVSTKYALGPYQESGAQISPKGISEVVILQHQLVKLIES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0VG85-F1 | 272-493 | 98.67 | 82.08 | View in AlphaFoldDB ↗ |