DPCfam | MC182200
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 231 ± 23 aa |
| Residues in low-complexity regions (%) | 12.35 |
| Residues in coiled-coil regions (%) | 0.4 |
| Predicted disordered residues (%) | 34.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006E13DDA | 1-169 | 169 | MAAWGNALLAGLVSPDDAALAIVGEDALHRVEGLPGEAGPVGLTLALGRLRGLGATGFRVALPVPGHPLGLSGPPDFNARALEAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P59980-F1 | 5-280 | 99.59 | 87.42 | View in AlphaFoldDB ↗ |