DPCfam | MC182158
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 54 ± 5 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.38 |
| Average transmembrane regions | 0.27 |
| Dominant Pfam architecture(s) | PF00665 |
| Sequences matching dominant architecture (%) | 0.88 |
| Average overlap percent | 28.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B7BAE8 | 27-85 | 59 | LRSQARAILAADFFETVTLTGARLYVLAVIEHATRRVRILGATPHPSAAWVTQAARNLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6FJX5-F1 | 48-79 | 60.71 | 85.60 | View in AlphaFoldDB ↗ |