DPCfam | MC182150
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Residues in low-complexity regions (%) | 0.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.5 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00782 |
| Sequences matching dominant architecture (%) | 59.63 |
| Average overlap percent | 9.56 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N4X6E2 | 2-74 | 73 | LSGLAFYPSLGYNLLRNYLQPHKWTWYNRVDDTLLVGALPFKSMQEELIQKENVGGVVCCVEDFELKYAYNAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6ND14-F1 | 44-107 | 97.01 | 88.26 | View in AlphaFoldDB ↗ |