DPCfam | MC182107
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1081 |
|---|---|
| Mean domain length (aa) | 403 ± 44 aa |
| Residues in low-complexity regions (%) | 3.8 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 24.29 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF13148 |
| Sequences matching dominant architecture (%) | 93.87 |
| Average overlap percent | 84.72 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101PJR9 | 343-757 | 415 | DRPTLAPFPVDLLGPNLAAIVKAVTAQVQVAPDIPAMIALPAISVAIGGRAQVRIRPGWSEAIALWTATVAGAGERKSAAEAPFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P52124-F1 | 7-419 | 98.33 | 92.14 | View in AlphaFoldDB ↗ |