DPCfam | MC1820
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 227 ± 19 aa |
| Residues in low-complexity regions (%) | 5.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.46 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7VYB7 | 149-392 | 244 | RAEETVPVSSSLPKFFDGSLSANFAPNSNCPSFLNAFLNNQTFNQCYPISLLMQGSQSFFQAQRSLVALTRVLDASCSPNVTFCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2HFF5-F1 | 107-324 | 97.31 | 94.71 | View in AlphaFoldDB ↗ |