DPCfam | MC181889
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 162 ± 12 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.18 |
| Average transmembrane regions | 0.26 |
| Dominant Pfam architecture(s) | PF00271 |
| Sequences matching dominant architecture (%) | 7.35 |
| Average overlap percent | 30.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4KL92 | 484-660 | 177 | LTRLLCAGDIHILVGTAALLGEGWDAPAINSLIIASAVGSYVQSNQMRGRAIRVDPMQPDKVANIWHLACVRTGKREQGNEDLLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FHB1-F1 | 526-671 | 91.82 | 91.74 | View in AlphaFoldDB ↗ |