DPCfam | MC181663
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Residues in low-complexity regions (%) | 4.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00155 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 21.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5P1D6 | 4-72 | 69 | IPRHLWQRLPEDDDGLLVAAQHYYQAPHILPVAGSQAALQALPALRAPGRVGMFFPSYAEHAHAWEKAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I468-F1 | 39-108 | 98.59 | 96.64 | View in AlphaFoldDB ↗ |