DPCfam | MC181424
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Residues in low-complexity regions (%) | 0.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.84 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06335 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 49.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6DWV9 | 47-132 | 86 | TGQETFVHIAQHRRRSRYAPESTWSAISNNKRGYKSQAHLQLGIWEDYVFMYLSIIDNPANKEKYATYLTDHHTFPDDFVYSTDH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1YM12-F1 | 50-137 | 97.78 | 96.74 | View in AlphaFoldDB ↗ |