DPCfam | MC181337
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 841 |
|---|---|
| Mean domain length (aa) | 371 ± 88 aa |
| Residues in low-complexity regions (%) | 4.4 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 20.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03710- PF08335 |
| Sequences matching dominant architecture (%) | 76.99 |
| Average overlap percent | 77.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W0BD73 | 113-403 | 291 | SDCADAIILHALTYCKEQLSRQHGIPRHASGEAAQLYVIAMGKLGGKELNYSSDVDLIFAFSEAGFTDGEKVISNQEYYNKVIQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8GL43-F1 | 45-420 | 99.19 | 92.58 | View in AlphaFoldDB ↗ |