DPCfam | MC181306
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 540 ± 98 aa |
| Residues in low-complexity regions (%) | 5.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01510 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 24.6 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00099D122C | 96-713 | 618 | AATEFGVPLPVLEAVSYYETRWEAHGGQVNAEAGYGPMNLTDLTASTLDTDGLSTQSPRYAKLLTAPAEHTAPAAAKLLGTDAAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P81717-F1 | 13-170 | 26.68 | 98.00 | View in AlphaFoldDB ↗ |