DPCfam | MC181027
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 247 ± 64 aa |
| Residues in low-complexity regions (%) | 4.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00788- PF00788 |
| Sequences matching dominant architecture (%) | 82.5 |
| Average overlap percent | 73.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5PET7 | 381-577 | 197 | QLLHQLLETTKGTESCAADYFLMEEKSFLSKEKSECRKPPFQRVIGPEEGLVQLLNSWFPEEGYVGRIIFKTREENLNERNVFQE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G5EFI8-F1 | 1600-1861 | 99.06 | 64.21 | View in AlphaFoldDB ↗ |