DPCfam | MC180951
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Residues in low-complexity regions (%) | 1.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06338 |
| Sequences matching dominant architecture (%) | 98.92 |
| Average overlap percent | 94.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002D72688 | 10-147 | 138 | ISSTVMMLLPYEDPFYRTQIHTTKGILYSPKTPLETIKELIITLNYSTYEGRRKVIIKKWDIQQNTPIPIKHRRFICAIPTKSPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40396-F1 | 15-151 | 98.55 | 96.48 | View in AlphaFoldDB ↗ |