DPCfam | MC180672
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00330- PF00694 |
| Sequences matching dominant architecture (%) | 77.61 |
| Average overlap percent | 32.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009BB07A5 | 426-579 | 154 | RADGNPNTHAFVASPELTLALTIAGSLCFNPLTDYLANRDGKQVKLAPPKGVDLPPKGFAVEDSGYIAPSADAKEEVIIAPDSNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54XS2-F1 | 465-618 | 99.35 | 96.38 | View in AlphaFoldDB ↗ |