DPCfam | MC18059
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 362 ± 38 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00008 |
| Sequences matching dominant architecture (%) | 16.33 |
| Average overlap percent | 4.71 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V1GY60 | 1-370 | 370 | MKFLTLFSILLLIWNLSECSCPFQYSSSIYGGVAGKRCITLVNITELRHIFNGNFLNSTQLYCKLAYKNGRAILNALDEEWRQIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z482-F1 | 22-381 | 99.18 | 38.79 | View in AlphaFoldDB ↗ |