DPCfam | MC180582
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Residues in low-complexity regions (%) | 1.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07017 |
| Sequences matching dominant architecture (%) | 8.33 |
| Average overlap percent | 79.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8VTW6 | 13-156 | 143 | MSAAWADEAPEAPTTSALWLNLGALTYHPNQSQGYNENNSGLGLEYRFKPDTSVMVGSFYNSVYRDTQYAAVNWQPIALGDWKLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I401-F1 | 23-150 | 97.04 | 95.85 | View in AlphaFoldDB ↗ |