DPCfam | MC180364
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 0.36 |
| Residues in coiled-coil regions (%) | 2.95 |
| Predicted disordered residues (%) | 7.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02928 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 68.42 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1K864 | 668-756 | 89 | VFELVPDDERQCAACRTTCFLSALTCSCNPERLVCLYHPNDLCSCTMQKKCLRYRYPLEDFPSLLYGVKVRAQSYDTWVSRVTEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80Y84-F1 | 687-759 | 96.05 | 91.69 | View in AlphaFoldDB ↗ |