DPCfam | MC180336
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Residues in low-complexity regions (%) | 16.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.66 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF10601 |
| Sequences matching dominant architecture (%) | 2.0 |
| Average overlap percent | 96.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174KU41 | 58-135 | 78 | VRCPRCGEHSLHPLSETTTSVQTSGGGYSSGKGCLGWLLFGPVGLLCGGLGQKQRTSIHTDNKLYWICNECGFKFRNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C5A3C3-F1 | 51-81 | 38.71 | 98.26 | View in AlphaFoldDB ↗ |