DPCfam | MC180298
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1991 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 1.12 |
| Predicted disordered residues (%) | 24.11 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12867 |
| Sequences matching dominant architecture (%) | 85.61 |
| Average overlap percent | 90.83 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DBF4C8 | 24-167 | 144 | GAFIDFVRKLQPCDEQIWIRPLGPQKWTIKEVVAHLLFWDQYFYEEVIRKIVLGQPLTLTEDIDVEAFNQKSAAWALSRSKDEIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O32078-F1 | 5-155 | 98.60 | 96.36 | View in AlphaFoldDB ↗ |