DPCfam | MC180294
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00082 |
| Sequences matching dominant architecture (%) | 90.17 |
| Average overlap percent | 8.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182FDY5 | 433-491 | 59 | VTSLVPKQETGVLNFLRKYPEYDGREVTIAILDSGVDPRAKGLEQVPGGDVKVIERYDC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0I859-F1 | 71-128 | 100.00 | 95.44 | View in AlphaFoldDB ↗ |