DPCfam | MC180188
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11175 |
| Sequences matching dominant architecture (%) | 79.71 |
| Average overlap percent | 37.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5B2Y2 | 57-184 | 128 | RNSKYDETTGKYVDWAANGDGGGIIRKEGEQLVFAEMDGPGCIWRIWSAAPQNGHVRIFLDGAETPAVDLPFIGYFDKKNEPFTH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A133CSL9-F1 | 49-165 | 95.69 | 97.60 | View in AlphaFoldDB ↗ |