DPCfam | MC180164
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 235 ± 18 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15515 |
| Sequences matching dominant architecture (%) | 99.13 |
| Average overlap percent | 95.97 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DDC025 | 199-452 | 254 | LLRRLTDVHHMGWVPSQRLEGDQAIAYTARNAGGYTLESLLGVSPNGRSEPDFQGWELKAHKVRSFDNPGSGTALTLMTPEPTGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34104-F1 | 26-265 | 92.41 | 92.90 | View in AlphaFoldDB ↗ |