DPCfam | MC17945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 107 ± 27 aa |
| Residues in low-complexity regions (%) | 1.1 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 13.97 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14294 |
| Sequences matching dominant architecture (%) | 75.16 |
| Average overlap percent | 71.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7NTC1 | 5-112 | 108 | TTILTQLLHLTDQLGFKKISAEEQADKRYRHFSARTQLFTMVFAQLTKQNSLRSIEHAISSDNDLYHAGITAKITRTNLAHANEY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45620-F1 | 7-123 | 96.83 | 88.55 | View in AlphaFoldDB ↗ |