DPCfam | MC179386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1831 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01052 |
| Sequences matching dominant architecture (%) | 99.33 |
| Average overlap percent | 90.65 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W9TIR9 | 100-177 | 78 | LEKLQLLFDIPLNVSVELGRRKYSLRDILNFHQGSMIQLDKLAGEPVDIYVNGRLIARGEVVVIDENFGVRITEIVSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P26419-F1 | 56-126 | 98.61 | 95.20 | View in AlphaFoldDB ↗ |