DPCfam | MC17925
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Residues in low-complexity regions (%) | 6.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.05 |
| Average transmembrane regions | 1.17 |
| Dominant Pfam architecture(s) | PF00939 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 17.21 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U0WW88 | 166-229 | 64 | IGISATTTTFIGLSLLILTNILDWQKDVLSNTTAWETFFWFGALIMMASFLSAFGFIHFVGDSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZM05-F1 | 310-369 | 98.36 | 92.25 | View in AlphaFoldDB ↗ |