DPCfam | MC179232
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 1.36 |
| Residues in coiled-coil regions (%) | 1.24 |
| Predicted disordered residues (%) | 13.0 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09724 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.88 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3MGY3 | 211-289 | 79 | RYTLRNILDRVQASEAEIRQAIEELPVVEIDGFYRLLDGEYYYRVQNHIVNYIESESMPLNKIPAGDIVDKVSETEPRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6GL75-F1 | 160-235 | 98.70 | 95.90 | View in AlphaFoldDB ↗ |